ahorradoras.com Traffic Analytics & Website Stats
ahorradoras.com is a domain having .com extension. ahorradoras.com is a e-commerce and shopping/e-commerce and shopping website. ahorradoras.com gets 150,247 traffic per month, the site is estimated to be worth $60,980.00. Over the last three months, ahorradoras.com's global ranking has increased from 393,688 to 352,652. ahorradoras.com's traffic has increased by 16.84% compared to last month, which is already a sign. Which countries sent the most traffic to ahorradoras.com lately? Last month Spain was the top country sending traffic to ahorradoras.com. ahorradoras.com's audience is 53.33% male and 46.67% female. The largest age group of visitors are 25 - 34 year olds.
- Traffic Report
-
Monthly Unique Visitors:
84,694
-
Monthly Pageviews:
150,247
- Estimated Valuation
-
Income Per Day:
$ 127
-
Estimated Worth:
$ 60,980
- Geography & Country Targeting
-
Countries Total Count:
13
-
Hot Country & Region:
Spain
- Search keywords & Backlinks
-
Keywords Total Count:
360
-
Backlinks Sites:
0
- Global Ranks
-
Global Rank:
352,652
-
Country Rank:
194
- Global Rank Change
-
Global Rank Change:
+18,182
-
Country Rank Change:
+118
- Web Information
- HTTP Information
- Whois Information
Web Server Information
-
Hosted IP Address:
172.67.73.125
-
Hosted Country:
US
-
Location Latitude:
37.330528259277
-
Location Longitude:
-121.83822631836
Page Title of ahorradoras.com
Meta Description of ahorradoras.com
Meta Tags of ahorradoras.com
Website Inpage Analysis
-
H1 Headings:
0
-
H2 Headings:
0
-
H3 Headings:
0
-
H4 Headings:
0
-
H5 Headings:
0
-
H6 Headings:
0
-
Total IFRAMEs:
0
-
Total Images:
0
-
Total Forms:
0
-
Total Scripts:
0
-
Google Adsense:
No Data
-
Google Analytics:
No Data
HTTP Header Analysis
Date: Sat, 08 Oct 2022 10:21:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.2.34
X-Redirect-By: WordPress
Location: https://www.ahorradoras.com/
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: connect-src 'self' http
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 756e25fab9fe8d22-KIX
Full WHOIS Lookup
Registry Domain ID: 1669580264_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ovh.com
Registrar URL: http://www.ovh.com
Updated Date: 2021-07-17T03:36:37Z
Creation Date: 2011-07-30T10:59:31Z
Registry Expiry Date: 2027-07-30T10:59:31Z
Registrar: OVH sas
Registrar IANA ID: 433
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +33.972101007
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DARWIN.NS.CLOUDFLARE.COM
Name Server: LIZ.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-11-23T17:22:59Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Similarly Ranked Websites
-
Primera Organización Iberoamericana sin ánimo de lucro fundada en España velando por los derechos de las personas con dislexia desde 2001
disfam.org 4,242,106 -
Fichas de matemáticas te ofrece los mejores cuadernos de matemáticas para imprimir en PDF. Recursos educativos de matemáticas GRATIS.
fichasdematematicas.com 761,281 -
Aprender todas las tablas de multiplicar del 1 al 12. Con el plan en 5 pasos, la prueba contrarreloj, juegos de tablas de multiplicar, fichas y obtén el diploma.
tablasdemultiplicar.com 229,532 -
Aquí encontrarás todas las tablas de multiplicar, además una forma fácil para aprendertelas ¡Míralas y compártelas!
tablas-multiplicar.com 3,672,316 -
Aprende las tablas de multiplicar del 1 al 10, con trucos para realizar una multiplicación sencilla ideales para niños, e imagen de cada tabla de multiplicar.
tablas-de-multiplicar.org 1,139,538 -
Fichas de Actividades y Cuadernos para niños. RECURSOS EDUCATIVOS gratis para casa y para clase. Ejercicios para infantil y primaria
edufichas.com 87,661 -
Revista digital dirigida a padres, madres, abuelos y mujeres embarazadas que quieran saber más sobre temas relacionados con bebés, niños y familia en general. Aportamos cada día contenido de calidad relacionado con la educación, la salud y mucho más.
etapainfantil.com 71,023 -
Masterwise Ideas educativas, creación de material didáctico en las áreas de lenguaje, matemáticas e historia, en concordancia con planes y Programas MINEDUC.
masterwise.cl 1,065,121 -
Recursos para trabajar en infantil y primaria
actividadesdeinfantilyprimaria.com 255,198 -
Portal de recursos educativos y material didáctico para niños de educación infantil y primaria.
webdelmaestro.com 244,386